Description
Our bioactive Interleukin-1 beta (IL-1 beta) Rat, E. coli Recombinant Protein is a non-glycosylated polypeptide chain that contains 153 amino acids and has a molecular mass of 17.3 kDa. The IL-1 beta is purified by proprietary chromatographic techniques.
Summary
IL-1 beta is a potent pro-inflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. Promotes Th17 differentiation of T-cells. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells.
Plays a role in angiogenesis by inducing VEGF production synergistically with TNF and IL6.
Involved in transduction of inflammation downstream of pyroptosis: its mature form is specifically released in the extracellular milieu by passing through the gasdermin-D (GSDMD) pore. Acts as a sensor of S. pyogenes infection in skin: cleaved and activated by pyogenes SpeB protease, leading to an inflammatory response that prevents bacterial growth during invasive skin infection.
Other Names
Rat Interleukin 1 beta, Rat Interleukin-1β, Interleukin-1b, IL-1β, IL-1b, IL1B, leukocytic pyrogen, leukocytic endogenous mediator, mononuclear cell factor, Catabolin, lymphocyte activating factor, UniProtKB# Q63264.
Source
Expressed in E. coli.
Formulation
Sterile filtered white lyophilized (freeze-dried) powder. Rat IL-1 beta was lyophilized from 0.2 µm filtered concentrated solution in PBS, pH 7.4, 5% trehalose, and 0.02 % Tween-20.
Amino Acid Sequence
MVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSF
VQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKK
KMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRD
IVDFTMEPVSS.
Purity
Greater than 96.0% as determined by:
- Analysis by RP-HPLC.
- Analysis by SDS-PAGE.
Biological Activity
The ED50 was found to be less than 0.1 ng/ml, determined by the dose dependent proliferation of mouse D10S cells, corresponding to a specific activity of 10,000,000 units/mg.
Reconstitution
It is recommended to reconstitute the lyophilized IL-1 beta in sterile 18MΩ-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Shipping
At ambient temperature. Upon receipt, store the product at the temperature recommended below.
Storage/Expiration
Lyophilized IL-1 beta, although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution, IL-1 beta should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Usage
This product is intended for Laboratory Research Use Only. Not for use in diagnostic or therapeutic procedures. This product may not be used as a pharmaceutical or veterinary drug, agricultural product, or food additive.