lyophilized protein vials

Streptavidin, E. coli Recombinant Protein

A179105MG
Regular price
$125.00
Sale price
$125.00
Regular price
$149.00
Temporarily out of stock
Unit price
per 
Shipping calculated at checkout.

Description

Streptavidin Streptomyces avidinii, E. coli Recombinant Protein. The molecular weight per tetramer is approximately 52 kDa.

Summary

Streptavidin is a tetrameric protein secreted by Streptomyces avidinii which binds firmly to biotin. Streptavidin is widely used in molecular biology through its unique high affinity for the vitamin biotin. The dissociation constant (Kd) of the biotin-streptavidin complex is about ~10-15 mol/L. The strong affinity recognition of biotin and biotinylated molecules has made streptavidin one of the most important components in diagnostics and laboratory kits. The streptavidin/biotin system has one of the biggest free energies of association of yet observed for noncovalent binding of a protein and small ligand in aqueous solution (K_assoc = 10**14). The complexes are also extremely stable over a wide range of temperature and pH.

Amino Acid Sequence

MAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLT
GRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGA
EARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS.

Source

E. coli

Formulation

Sterile filtered white lyophilized (freeze-dried) powder. Lyophilized in 10mM potassium phosphate buffer pH 6.5.

Purity

Greater than 98.0% as determined by SDS-PAGE and HPLC.

Biological Activity

> 17 U/mg (one unit binds 1 μg D-biotin).

Proteolytic Activity

< 10-3 U/mg protein (Azocoll, 25 °C, 24 h, pH 8.0).

Reconstitution

It is recommended to reconstitute the lyophilized Streptavidin in sterile 18MΩ-cm H2O not less than 0.5 mg/ml, which can then be further diluted to other aqueous solutions.

Shipping

At ambient temperature.  Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store at -20°C. Please prevent freeze/thaw cycles.

Usage

This product is intended to Laboratory Research Use Only.  This product may not be used a drug, agricultural product, or food additives.

Resources

Want to learn more about Streptavidin? We have compiled the links below which contain information that you may find interesting.