
Description
Growth Hormone (GH) Zebrafish, E. coli Recombinant is a single, non-glycosylated polypeptide chain containing 185 amino acids with an additional Ala at the N-terminus and has a molecular mass of 21.18 kDa. The GH Zebrafish is purified by proprietary chromatographic techniques.
Summary
GH, also known as somatotropin, is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed in the pituitary but not in placental tissue as is the case for the other four genes in the growth hormone locus. Mutations in or deletions of the gene lead to growth hormone deficiency and short stature.
Amino Acid Sequence
AQRLFNNAVIRVQHLHQLAAKMINDFEEGLMPEERRQLSKIFPL
SFCNSDSIETPTGKDETQKSSMLKLLRISFRLIESWEFPSQTLSS
TISNSLTIGNPNLITEKLVDLKMGISVLIKGCLDGQPNMDDNDSL
PLPFEDFYLTVGETSLRESFRLLACFKKDMHKVETYLRVANCRRSLDSNCTL
Type
Recombinant protein
Source
E. coli
Purity
Greater than 99.0%.
Biological Activity
Zebrafish Growth Hormone is biologically active in PDF-P1 3B9 cells stably transfected with rabbit GH receptors.
Formulation
Sterile-filtered white lyophilized (freeze-dried) powder. The protein was lyophilized from a concentrated (1 mg/ml) solution with 0.5% NaHCO3 pH-8.
Reconstitution
It is recommended to reconstitute the lyophilized Zebrafish Growth Hormone in 0.4% NaHCO3 or water adjusted to pH-9, not less than 100 µg/ml, which can then be further diluted to other aqueous solutions, preferably in a presence of a carrier protein such as BSA or similar.
Shipping
Shipped at ambient temperature. Upon receipt, store at the temperature recommended below.
Storage/Expiration
Lyophilized Zebrafish Growth-Hormone, although stable at room temperature for at least two weeks, should be stored desiccated below -18°C. Upon reconstitution and filter sterilization, GH can be stored at 4°C, pH 9 for up to 4 weeks. For long term storage and more diluted solutions it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Usage
This product is intended for Laboratory Research Use Only. Not for use in diagnostic or therapeutic procedures. This product may not be used as a pharmaceutical or veterinary drug, agricultural product, or food additive.